SCOP 1.63: Domain d1ive__: 1ive -

Lineage for d1ive__ (1ive -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)

6. Protein Influenza neuraminidase [50943] (2 species)

7. Species Influenza A virus, different strains [TaxId:11320] [50944] (48 PDB entries)

8. Domain d1ive__: 1ive - [27587]
   complexed with ca, fuc, man, nag, st3

Details for d1ive__

PDB Entry: 1ive, 2.4 Å

PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase

SCOP Domain Sequences for d1ive__:

Sequence; same for both SEQRES and ATOM records:

>d1ive__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

Timeline for d1ive__:

• d1ive__ first appeared (with stable ids) in SCOP 1.55
  
• d1ive__ appears in SCOP 1.61
  
• d1ive__ appears in SCOP 1.65
  
• d1ive__ appears in the current release, SCOPe 2.08, called d1ivea_