Lineage for d5cm4a_ (5cm4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347717Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2347718Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2347748Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 2347749Protein automated matches [274417] (1 species)
    not a true protein
  7. 2347750Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries)
  8. 2347761Domain d5cm4a_: 5cm4 A: [275852]
    automated match to d1ijya_
    complexed with nag

Details for d5cm4a_

PDB Entry: 5cm4 (more details), 2.4 Å

PDB Description: crystal structure of human frizzled 4 cysteine-rich domain (crd)
PDB Compounds: (A:) Frizzled-4

SCOPe Domain Sequences for d5cm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cm4a_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegpg
d

SCOPe Domain Coordinates for d5cm4a_:

Click to download the PDB-style file with coordinates for d5cm4a_.
(The format of our PDB-style files is described here.)

Timeline for d5cm4a_: