SCOPe 2.08: Domain d5cm4a_: 5cm4 A:

Lineage for d5cm4a_ (5cm4 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
   Core: 3 helices; irregular array; disulfide-rich

4. Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families)
   automatically mapped to Pfam PF01392

5. Family a.141.1.0: automated matches [274414] (1 protein)
   not a true family

6. Protein automated matches [274417] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries)

8. Domain d5cm4a_: 5cm4 A: [275852]
   automated match to d1ijya_
   complexed with nag

Details for d5cm4a_

PDB Entry: 5cm4, 2.4 Å

PDB Description: crystal structure of human frizzled 4 cysteine-rich domain (crd)

PDB Compounds: (A:) Frizzled-4

SCOPe Domain Sequences for d5cm4a_:

Sequence; same for both SEQRES and ATOM records:

>d5cm4a_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegpg
d

Timeline for d5cm4a_:

• d5cm4a_ first appeared in SCOPe 2.05
  
• d5cm4a_ appears in SCOPe 2.07