SCOPe 2.05: Domain d5cixa_: 5cix A:

Lineage for d5cixa_ (5cix A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (66 PDB entries)

8. Domain d5cixa_: 5cix A: [275850]
   automated match to d4dwma_
   complexed with 211, nag, po4

Details for d5cixa_

PDB Entry: 5cix, 1.88 Å

PDB Description: structure of the complex of type 1 ribosome inactivating protein with triethanolamine at 1.88 angstrom resolution

PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d5cixa_:

Sequence; same for both SEQRES and ATOM records:

>d5cixa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d5cixa_:

• d5cixa_ is new in SCOPe 2.05-stable
  
• d5cixa_ appears in SCOPe 2.06
  
• d5cixa_ appears in the current release, SCOPe 2.08