Lineage for d1inha_ (1inh A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17047Protein Influenza neuraminidase [50943] (2 species)
  7. 17048Species Influenza A virus, different strains [TaxId:11320] [50944] (41 PDB entries)
  8. 17085Domain d1inha_: 1inh A: [27585]

Details for d1inha_

PDB Entry: 1inh (more details), 2.4 Å

PDB Description: influenza a subtype n2 neuraminidase complexed with aromatic bana111 inhibitor

SCOP Domain Sequences for d1inha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inha_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOP Domain Coordinates for d1inha_:

Click to download the PDB-style file with coordinates for d1inha_.
(The format of our PDB-style files is described here.)

Timeline for d1inha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1inhb_