| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries) Uniprot P21707 271-419 ! Uniprot P21707 271-419 |
| Domain d5ccja_: 5ccj A: [275846] Other proteins in same PDB: d5ccjd2 automated match to d2lhaa_ complexed with gol, so4; mutant |
PDB Entry: 5ccj (more details), 1.65 Å
SCOPe Domain Sequences for d5ccja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ccja_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslayvptagkltvvilaaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpwynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanpaapiaqwhtlqveeevdamla
Timeline for d5ccja_:
View in 3DDomains from other chains: (mouse over for more information) d5ccjb_, d5ccjc_, d5ccjd1, d5ccjd2 |