| Class g: Small proteins [56992] (100 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein automated matches [190700] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries) |
| Domain d5c7aa_: 5c7a A: [275841] automated match to d1tfqa_ complexed with 4ye, zn |
PDB Entry: 5c7a (more details), 2.36 Å
SCOPe Domain Sequences for d5c7aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c7aa_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr
Timeline for d5c7aa_: