Lineage for d5c3ha_ (5c3h A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264524Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2264525Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2264526Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2264660Protein automated matches [190700] (1 species)
    not a true protein
  7. 2264661Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries)
  8. 2264733Domain d5c3ha_: 5c3h A: [275838]
    automated match to d1tfqa_
    complexed with 4xe, zn

Details for d5c3ha_

PDB Entry: 5c3h (more details), 2.65 Å

PDB Description: fragment-based drug discovery targeting inhibitor of apoptosis proteins: compound 1
PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d5c3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3ha_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

SCOPe Domain Coordinates for d5c3ha_:

Click to download the PDB-style file with coordinates for d5c3ha_.
(The format of our PDB-style files is described here.)

Timeline for d5c3ha_: