SCOPe 2.05: Domain d5c0la_: 5c0l A:

Lineage for d5c0la_ (5c0l A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (35 PDB entries)

8. Domain d5c0la_: 5c0l A: [275836]
   automated match to d1tfqa_
   complexed with 4wj, zn

Details for d5c0la_

PDB Entry: 5c0l, 2.6 Å

PDB Description: fragment-based drug discovery targeting inhibitor of apoptosis proteins: compound 2

PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d5c0la_:

Sequence; same for both SEQRES and ATOM records:

>d5c0la_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

Timeline for d5c0la_:

• d5c0la_ is new in SCOPe 2.05-stable
  
• d5c0la_ appears in SCOPe 2.06
  
• d5c0la_ appears in the current release, SCOPe 2.08