Lineage for d5c0la_ (5c0l A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038266Domain d5c0la_: 5c0l A: [275836]
    automated match to d1tfqa_
    complexed with 4wj, zn

Details for d5c0la_

PDB Entry: 5c0l (more details), 2.6 Å

PDB Description: fragment-based drug discovery targeting inhibitor of apoptosis proteins: compound 2
PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d5c0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c0la_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

SCOPe Domain Coordinates for d5c0la_:

Click to download the PDB-style file with coordinates for d5c0la_.
(The format of our PDB-style files is described here.)

Timeline for d5c0la_: