Lineage for d5br0d_ (5br0 D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2591826Domain d5br0d_: 5br0 D: [275832]
    Other proteins in same PDB: d5br0a_, d5br0c_
    automated match to d4kthd_
    complexed with bma, fuc, man, nag

Details for d5br0d_

PDB Entry: 5br0 (more details), 2.39 Å

PDB Description: crystal structure of hemagglutinin of a/taiwan/2/2013 (h6n1)
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5br0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br0d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq

SCOPe Domain Coordinates for d5br0d_:

Click to download the PDB-style file with coordinates for d5br0d_.
(The format of our PDB-style files is described here.)

Timeline for d5br0d_: