Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d5br0a_: 5br0 A: [275831] Other proteins in same PDB: d5br0b_, d5br0d_ automated match to d3htta_ complexed with nag |
PDB Entry: 5br0 (more details), 2.39 Å
SCOPe Domain Sequences for d5br0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5br0a_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]} dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl wigecpkyvkseslrlatglrnvpqi
Timeline for d5br0a_: