Lineage for d5br6b_ (5br6 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969779Domain d5br6b_: 5br6 B: [275826]
    Other proteins in same PDB: d5br6a_, d5br6c_
    automated match to d4kthd_
    complexed with bma, fuc, gal, man, nag, sia

Details for d5br6b_

PDB Entry: 5br6 (more details), 2.43 Å

PDB Description: crystal structure of hemagglutinin of a/taiwan/2/2013 (h6n1) in complex with lstc
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5br6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br6b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq

SCOPe Domain Coordinates for d5br6b_:

Click to download the PDB-style file with coordinates for d5br6b_.
(The format of our PDB-style files is described here.)

Timeline for d5br6b_: