Lineage for d5br3b_ (5br3 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041109Domain d5br3b_: 5br3 B: [275823]
    Other proteins in same PDB: d5br3a_, d5br3c_
    automated match to d4kthd_
    complexed with nag

Details for d5br3b_

PDB Entry: 5br3 (more details), 2.55 Å

PDB Description: crystal structure of hemagglutinin of a/taiwan/2/2013 (h6n1) in complex with lsta
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5br3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br3b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq

SCOPe Domain Coordinates for d5br3b_:

Click to download the PDB-style file with coordinates for d5br3b_.
(The format of our PDB-style files is described here.)

Timeline for d5br3b_: