| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus [TaxId:1454274] [275816] (1 PDB entry) |
| Domain d5bqyd_: 5bqy D: [275821] Other proteins in same PDB: d5bqya_, d5bqyc_, d5bqye_ automated match to d4d00d_ complexed with nag |
PDB Entry: 5bqy (more details), 2.78 Å
SCOPe Domain Sequences for d5bqyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bqyd_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 1454274]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqki
Timeline for d5bqyd_: