Lineage for d5bqyc_ (5bqy C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776236Species Influenza A virus (a/chicken/guangdong/s1312/2010(h6n2)) [TaxId:1454273] [275814] (1 PDB entry)
  8. 2776238Domain d5bqyc_: 5bqy C: [275820]
    Other proteins in same PDB: d5bqyb_, d5bqyd_, d5bqyf_
    automated match to d3qqea_
    complexed with nag

Details for d5bqyc_

PDB Entry: 5bqy (more details), 2.78 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with avian-like receptor lsta
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5bqyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqyc_ b.19.1.0 (C:) automated matches {Influenza A virus (a/chicken/guangdong/s1312/2010(h6n2)) [TaxId: 1454273]}
dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
igecpkyvkskslrlatglrnvpq

SCOPe Domain Coordinates for d5bqyc_:

Click to download the PDB-style file with coordinates for d5bqyc_.
(The format of our PDB-style files is described here.)

Timeline for d5bqyc_: