Lineage for d1nmca_ (1nmc A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 807194Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 807195Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 807208Protein Influenza neuraminidase [50943] (2 species)
  7. 807209Species Influenza A virus, different strains [TaxId:11320] [50944] (54 PDB entries)
    Uniprot P03472 84-470
  8. 807248Domain d1nmca_: 1nmc A: [27582]
    Other proteins in same PDB: d1nmcb_, d1nmcc_, d1nmch_, d1nmcl_
    complexed with ca, man, nag

Details for d1nmca_

PDB Entry: 1nmc (more details), 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase
PDB Compounds: (A:) Neuraminidase

SCOP Domain Sequences for d1nmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d1nmca_:

Click to download the PDB-style file with coordinates for d1nmca_.
(The format of our PDB-style files is described here.)

Timeline for d1nmca_: