SCOPe 2.08: Domain d5bqyb_: 5bqy B:

Lineage for d5bqyb_ (5bqy B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus [TaxId:1454274] [275816] (1 PDB entry)

8. Domain d5bqyb_: 5bqy B: [275819]
   Other proteins in same PDB: d5bqya_, d5bqyc_, d5bqye_
   automated match to d4d00d_
   complexed with nag

Details for d5bqyb_

PDB Entry: 5bqy, 2.78 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with avian-like receptor lsta

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5bqyb_:

Sequence; same for both SEQRES and ATOM records:

>d5bqyb_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 1454274]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrq

Timeline for d5bqyb_:

• d5bqyb_ first appeared in SCOPe 2.05
  
• d5bqyb_ appears in SCOPe 2.07