Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza A virus (a/chicken/guangdong/s1312/2010(h6n2)) [TaxId:1454273] [275814] (1 PDB entry) |
Domain d5bqye_: 5bqy E: [275818] Other proteins in same PDB: d5bqyb_, d5bqyd_, d5bqyf_ automated match to d3qqea_ complexed with gal, nag, sia |
PDB Entry: 5bqy (more details), 2.78 Å
SCOPe Domain Sequences for d5bqye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bqye_ b.19.1.0 (E:) automated matches {Influenza A virus (a/chicken/guangdong/s1312/2010(h6n2)) [TaxId: 1454273]} dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw igecpkyvkskslrlatglrnvpq
Timeline for d5bqye_: