Lineage for d5bqye_ (5bqy E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2385910Species Influenza A virus (a/chicken/guangdong/s1312/2010(h6n2)) [TaxId:1454273] [275814] (1 PDB entry)
  8. 2385913Domain d5bqye_: 5bqy E: [275818]
    Other proteins in same PDB: d5bqyb_, d5bqyd_, d5bqyf_
    automated match to d3qqea_
    complexed with gal, nag, sia

Details for d5bqye_

PDB Entry: 5bqy (more details), 2.78 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with avian-like receptor lsta
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5bqye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqye_ b.19.1.0 (E:) automated matches {Influenza A virus (a/chicken/guangdong/s1312/2010(h6n2)) [TaxId: 1454273]}
dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
igecpkyvkskslrlatglrnvpq

SCOPe Domain Coordinates for d5bqye_:

Click to download the PDB-style file with coordinates for d5bqye_.
(The format of our PDB-style files is described here.)

Timeline for d5bqye_: