Lineage for d5bnyc_ (5bny C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778701Species Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275806] (2 PDB entries)
  8. 1778703Domain d5bnyc_: 5bny C: [275811]
    Other proteins in same PDB: d5bnyb_, d5bnyd_, d5bnyf_
    automated match to d3qqea_
    complexed with nag

Details for d5bnyc_

PDB Entry: 5bny (more details), 2.66 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5bnyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnyc_ b.19.1.0 (C:) automated matches {Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
igecpkyvkskslrlatglrnvpq

SCOPe Domain Coordinates for d5bnyc_:

Click to download the PDB-style file with coordinates for d5bnyc_.
(The format of our PDB-style files is described here.)

Timeline for d5bnyc_: