Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (23 species) not a true protein |
Species Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275806] (2 PDB entries) |
Domain d5bnyc_: 5bny C: [275811] Other proteins in same PDB: d5bnyb_, d5bnyd_, d5bnyf_ automated match to d3qqea_ complexed with nag |
PDB Entry: 5bny (more details), 2.66 Å
SCOPe Domain Sequences for d5bnyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnyc_ b.19.1.0 (C:) automated matches {Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]} dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw igecpkyvkskslrlatglrnvpq
Timeline for d5bnyc_: