SCOPe 2.07: Domain d5bnye_: 5bny E:

Lineage for d5bnye_ (5bny E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275806] (2 PDB entries)

8. Domain d5bnye_: 5bny E: [275810]
   Other proteins in same PDB: d5bnyb_, d5bnyd_, d5bnyf_
   automated match to d3qqea_
   complexed with nag

Details for d5bnye_

PDB Entry: 5bny, 2.66 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6)

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d5bnye_:

Sequence; same for both SEQRES and ATOM records:

>d5bnye_ b.19.1.0 (E:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
igecpkyvkskslrlatglrnvpq

Timeline for d5bnye_:

• d5bnye_ first appeared in SCOPe 2.05
  
• d5bnye_ appears in SCOPe 2.06
  
• d5bnye_ appears in the current release, SCOPe 2.08