Lineage for d1nmcn_ (1nmc N:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959663Protein Influenza neuraminidase [50943] (2 species)
  7. 959664Species Influenza A virus, different strains [TaxId:11320] [50944] (54 PDB entries)
    Uniprot P03472 84-470
  8. 959718Domain d1nmcn_: 1nmc N: [27581]
    Other proteins in same PDB: d1nmcb_, d1nmcc_, d1nmch_, d1nmcl_
    complexed with ca, man, nag

Details for d1nmcn_

PDB Entry: 1nmc (more details), 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase
PDB Compounds: (N:) Neuraminidase

SCOPe Domain Sequences for d1nmcn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmcn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOPe Domain Coordinates for d1nmcn_:

Click to download the PDB-style file with coordinates for d1nmcn_.
(The format of our PDB-style files is described here.)

Timeline for d1nmcn_: