SCOPe 2.07: Domain d5a00a1: 5a00 A:662-796

Lineage for d5a00a1 (5a00 A:662-796)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)

8. Domain d5a00a1: 5a00 A:662-796 [275798]
   Other proteins in same PDB: d5a00a2
   automated match to d4gv2a1
   complexed with d7n, so4

Details for d5a00a1

PDB Entry: 5a00, 2.75 Å

PDB Description: structure of human parp1 catalytic domain bound to an isoindolinone inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5a00a1:

Sequence, based on SEQRES records:

>d5a00a1 a.41.1.0 (A:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records):

>d5a00a1 a.41.1.0 (A:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdppllnnadsvqakvemldnlldievaysllrggskdpi
dvnyek

Timeline for d5a00a1:

• d5a00a1 first appeared in SCOPe 2.05
  
• d5a00a1 appears in SCOPe 2.06
  
• d5a00a1 appears in the current release, SCOPe 2.08