Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein pak1 [56146] (1 species) OPK group; PAK/STE20 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56147] (18 PDB entries) |
Domain d4zlob_: 4zlo B: [275797] automated match to d3q4za_ complexed with 4pv, gol |
PDB Entry: 4zlo (more details), 2.5 Å
SCOPe Domain Sequences for d4zlob_:
Sequence, based on SEQRES records: (download)
>d4zlob_ d.144.1.7 (B:) pak1 {Human (Homo sapiens) [TaxId: 9606]} ileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevaikqmnlqqqpkkeli ineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaavcre clqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtpywma pevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsa ifrdflnrclemdvekrgsakellqhqflkiakplssltpliaaakeatkn
>d4zlob_ d.144.1.7 (B:) pak1 {Human (Homo sapiens) [TaxId: 9606]} ileklrsivsvkkkytrfekigqvytamgqevaikqmeliineilvmrenknpnivnyld syvvmeylaggsltdvvtetcmdegqiaavcreclqaleflhsnqvihrdiksdnillgm dgsvkltdfgfcaqitpeqskrstmvgtpywmapevvtrkaygpkvdiwslgimaiemie geppylnenplralyliatngtpelqnpeklsaifrdflnrclemdvekrgsakellqhq flkiakplssltpliaaakeatkn
Timeline for d4zlob_: