Lineage for d1ncan_ (1nca N:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065006Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2065091Domain d1ncan_: 1nca N: [27579]
    Other proteins in same PDB: d1ncah1, d1ncah2, d1ncal1, d1ncal2
    complexed with ca, nag

Details for d1ncan_

PDB Entry: 1nca (more details), 2.5 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
PDB Compounds: (N:) influenza a subtype n9 neuraminidase

SCOPe Domain Sequences for d1ncan_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncan_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
rgkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnn
nasaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfke
gkilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyics
pvltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvp
naltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
snsivsmcssteflgqwdwpdgakieyfl

SCOPe Domain Coordinates for d1ncan_:

Click to download the PDB-style file with coordinates for d1ncan_.
(The format of our PDB-style files is described here.)

Timeline for d1ncan_: