SCOPe 2.07: Domain d4zhfe_: 4zhf E:

Lineage for d4zhfe_ (4zhf E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d4zhfe_: 4zhf E: [275782]
   automated match to d1l6ma_
   complexed with 4ol, gol, so4, zcm

Details for d4zhfe_

PDB Entry: 4zhf, 2.45 Å

PDB Description: siderocalin-mediated recognition and cellular uptake of actinides

PDB Compounds: (E:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4zhfe_:

Sequence; same for both SEQRES and ATOM records:

>d4zhfe_ b.60.1.1 (E:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelked
ksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamv
ffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d4zhfe_:

• d4zhfe_ first appeared in SCOPe 2.05
  
• d4zhfe_ appears in SCOPe 2.06
  
• d4zhfe_ appears in the current release, SCOPe 2.08