Lineage for d4yz7a_ (4yz7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733349Species Bothrops pirajai [TaxId:113192] [188615] (4 PDB entries)
  8. 2733354Domain d4yz7a_: 4yz7 A: [275763]
    automated match to d3qnla_
    complexed with 9ar, pe4, so4

Details for d4yz7a_

PDB Entry: 4yz7 (more details), 1.96 Å

PDB Description: crystal structure of piratoxin i (prtx-i) complexed to aristolochic acid
PDB Compounds: (A:) Basic phospholipase A2 homolog piratoxin-1

SCOPe Domain Sequences for d4yz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yz7a_ a.133.1.2 (A:) automated matches {Bothrops pirajai [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynklyryhlkpfckkadd
c

SCOPe Domain Coordinates for d4yz7a_:

Click to download the PDB-style file with coordinates for d4yz7a_.
(The format of our PDB-style files is described here.)

Timeline for d4yz7a_: