SCOPe 2.05: Domain d4z27a_: 4z27 A:

Lineage for d4z27a_ (4z27 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Hoeflea phototrophica [TaxId:411684] [275106] (6 PDB entries)

8. Domain d4z27a_: 4z27 A: [275760]
   automated match to d3t2xa_

Details for d4z27a_

PDB Entry: 4z27, 1.34 Å

PDB Description: crystal structure of apo short hoefavidin

PDB Compounds: (A:) Avidin family

SCOPe Domain Sequences for d4z27a_:

Sequence; same for both SEQRES and ATOM records:

>d4z27a_ b.61.1.0 (A:) automated matches {Hoeflea phototrophica [TaxId: 411684]}
dmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsgayy
sgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgqdd
fmqs

Timeline for d4z27a_:

• d4z27a_ is new in SCOPe 2.05-stable
  
• d4z27a_ appears in SCOPe 2.06
  
• d4z27a_ appears in the current release, SCOPe 2.08