Lineage for d4yu7b_ (4yu7 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750608Protein automated matches [190139] (25 species)
    not a true protein
  7. 1750629Species Bothrops pirajai [TaxId:113192] [188615] (4 PDB entries)
  8. 1750633Domain d4yu7b_: 4yu7 B: [275756]
    automated match to d3qnla_
    complexed with dhc, pe4, so4

Details for d4yu7b_

PDB Entry: 4yu7 (more details), 1.65 Å

PDB Description: crystal structure of piratoxin i (prtx-i) complexed to caffeic acid
PDB Compounds: (B:) Basic phospholipase A2 homolog piratoxin-1

SCOPe Domain Sequences for d4yu7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yu7b_ a.133.1.2 (B:) automated matches {Bothrops pirajai [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynklyryhlkpfckkadd
c

SCOPe Domain Coordinates for d4yu7b_:

Click to download the PDB-style file with coordinates for d4yu7b_.
(The format of our PDB-style files is described here.)

Timeline for d4yu7b_: