SCOPe 2.08: Domain d4ytnf2: 4ytn F:139-282

Lineage for d4ytnf2 (4ytn F:139-282)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.0: automated matches [230426] (1 protein)
   not a true family

6. Protein automated matches [230427] (2 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries)

8. Domain d4ytnf2: 4ytn F:139-282 [275751]
   Other proteins in same PDB: d4ytnb1, d4ytnf1
   automated match to d3vrbb2
   complexed with f3s, fad, fd8, fes, hem, mli, sf4

Details for d4ytnf2

PDB Entry: 4ytn, 3 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2- (trifluoromethyl)benzamide

PDB Compounds: (F:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4ytnf2:

Sequence; same for both SEQRES and ATOM records:

>d4ytnf2 a.1.2.0 (F:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpanf

Timeline for d4ytnf2:

• d4ytnf2 first appeared in SCOPe 2.05
  
• d4ytnf2 appears in SCOPe 2.07