Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein automated matches [254461] (3 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [255743] (5 PDB entries) |
Domain d4ytpd_: 4ytp D: [275749] Other proteins in same PDB: d4ytpb1, d4ytpb2 automated match to d1zoyd_ complexed with e23, f3s, fad, fes, hem, sf4 |
PDB Entry: 4ytp (more details), 3.1 Å
SCOPe Domain Sequences for d4ytpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ytpd_ f.21.2.2 (D:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg dalqkvakagllalsaftfaglcyfnyhdvgickavamlwkl
Timeline for d4ytpd_: