Lineage for d4ytnb2 (4ytn B:139-282)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689722Family a.1.2.0: automated matches [230426] (1 protein)
    not a true family
  6. 2689723Protein automated matches [230427] (2 species)
    not a true protein
  7. 2689728Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries)
  8. 2689737Domain d4ytnb2: 4ytn B:139-282 [275748]
    Other proteins in same PDB: d4ytnb1, d4ytnf1
    automated match to d3vrbb2
    complexed with f3s, fad, fd8, fes, hem, mli, sf4

Details for d4ytnb2

PDB Entry: 4ytn (more details), 3 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2- (trifluoromethyl)benzamide
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4ytnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ytnb2 a.1.2.0 (B:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpanf

SCOPe Domain Coordinates for d4ytnb2:

Click to download the PDB-style file with coordinates for d4ytnb2.
(The format of our PDB-style files is described here.)

Timeline for d4ytnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ytnb1