SCOPe 2.07: Domain d4ytnb1: 4ytn B:33-138

Lineage for d4ytnb1 (4ytn B:33-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (22 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries)

8. Domain d4ytnb1: 4ytn B:33-138 [275747]
   Other proteins in same PDB: d4ytnb2, d4ytnf2
   automated match to d3vrbb1
   complexed with f3s, fad, fd8, fes, hem, mli, sf4

Details for d4ytnb1

PDB Entry: 4ytn, 3 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2- (trifluoromethyl)benzamide

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4ytnb1:

Sequence; same for both SEQRES and ATOM records:

>d4ytnb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

Timeline for d4ytnb1:

• d4ytnb1 first appeared in SCOPe 2.05
  
• d4ytnb1 appears in SCOPe 2.06