| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.0: automated matches [230426] (1 protein) not a true family |
| Protein automated matches [230427] (2 species) not a true protein |
| Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries) |
| Domain d4ysxf2: 4ysx F:139-282 [275744] Other proteins in same PDB: d4ysxb1, d4ysxf1 automated match to d3vrbb2 complexed with e23, eph, f3s, fad, fes, hem, mli, sf4 |
PDB Entry: 4ysx (more details), 2.25 Å
SCOPe Domain Sequences for d4ysxf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ysxf2 a.1.2.0 (F:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpanf
Timeline for d4ysxf2: