Lineage for d4ysxb1 (4ysx B:33-138)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894403Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1894404Protein automated matches [191164] (14 species)
    not a true protein
  7. 1894442Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (7 PDB entries)
  8. 1894443Domain d4ysxb1: 4ysx B:33-138 [275741]
    Other proteins in same PDB: d4ysxb2, d4ysxf2
    automated match to d3vrbb1
    complexed with e23, eph, f3s, fad, fes, hem, mli, sf4

Details for d4ysxb1

PDB Entry: 4ysx (more details), 2.25 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4ysxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ysxb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

SCOPe Domain Coordinates for d4ysxb1:

Click to download the PDB-style file with coordinates for d4ysxb1.
(The format of our PDB-style files is described here.)

Timeline for d4ysxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ysxb2