Lineage for d4yoia_ (4yoi A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2067150Species Tylonycteris bat coronavirus hku4 [TaxId:694007] [228570] (6 PDB entries)
  8. 2067155Domain d4yoia_: 4yoi A: [275734]
    automated match to d2ynaa_
    complexed with 4f4, act, fmt

Details for d4yoia_

PDB Entry: 4yoi (more details), 1.82 Å

PDB Description: structure of hku4 3clpro bound to non-covalent inhibitor 1a
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d4yoia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yoia_ b.47.1.0 (A:) automated matches {Tylonycteris bat coronavirus hku4 [TaxId: 694007]}
sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydallis
ktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlac
yngkptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssf
dgvmygafedkqthqlqltdkyctinvvawlyaavlngckwfvkptrvgivtynewalsn
qftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftpddvnmqv
mgvvmq

SCOPe Domain Coordinates for d4yoia_:

Click to download the PDB-style file with coordinates for d4yoia_.
(The format of our PDB-style files is described here.)

Timeline for d4yoia_: