SCOPe 2.07: Domain d1ncbn_: 1ncb N:

Lineage for d1ncbn_ (1ncb N:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein Influenza neuraminidase [50943] (8 species)

7. Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
   Uniprot P03472 84-470

8. Domain d1ncbn_: 1ncb N: [27573]
   Other proteins in same PDB: d1ncbh1, d1ncbh2, d1ncbl1, d1ncbl2
   complexed with ca, nag; mutant

Details for d1ncbn_

PDB Entry: 1ncb, 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

PDB Compounds: (N:) influenza a subtype n9 neuraminidase

SCOPe Domain Sequences for d1ncbn_:

Sequence; same for both SEQRES and ATOM records:

>d1ncbn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
rgkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnn
nasaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfke
gkilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyics
pvltdnprpddptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvp
naltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
snsivsmcssteflgqwdwpdgakieyfl

Timeline for d1ncbn_:

• d1ncbn_ first appeared (with stable ids) in SCOP 1.55
  
• d1ncbn_ appears in SCOPe 2.06
  
• d1ncbn_ appears in the current release, SCOPe 2.08