Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (20 species) not a true protein |
Species Tylonycteris bat coronavirus hku4 [TaxId:694007] [228570] (6 PDB entries) |
Domain d4yoga_: 4yog A: [275729] automated match to d2ynaa_ complexed with 4f5, act |
PDB Entry: 4yog (more details), 2 Å
SCOPe Domain Sequences for d4yoga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yoga_ b.47.1.0 (A:) automated matches {Tylonycteris bat coronavirus hku4 [TaxId: 694007]} sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydallis ktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlac yngkptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssf dgvmygafedkqthqlqltdkyctinvvawlyaavlngckwfvkptrvgivtynewalsn qftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftpddvnmqv mgvvmq
Timeline for d4yoga_: