Lineage for d4yoga_ (4yog A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795550Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1795551Protein automated matches [190438] (20 species)
    not a true protein
  7. 1795748Species Tylonycteris bat coronavirus hku4 [TaxId:694007] [228570] (6 PDB entries)
  8. 1795757Domain d4yoga_: 4yog A: [275729]
    automated match to d2ynaa_
    complexed with 4f5, act

Details for d4yoga_

PDB Entry: 4yog (more details), 2 Å

PDB Description: hku4-3clpro bound to non-covalent inhibitor 3b
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d4yoga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yoga_ b.47.1.0 (A:) automated matches {Tylonycteris bat coronavirus hku4 [TaxId: 694007]}
sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydallis
ktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlac
yngkptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssf
dgvmygafedkqthqlqltdkyctinvvawlyaavlngckwfvkptrvgivtynewalsn
qftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftpddvnmqv
mgvvmq

SCOPe Domain Coordinates for d4yoga_:

Click to download the PDB-style file with coordinates for d4yoga_.
(The format of our PDB-style files is described here.)

Timeline for d4yoga_: