SCOPe 2.07: Domain d4ymab_: 4yma B:

Lineage for d4ymab_ (4yma B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d4ymab_: 4yma B: [275725]
   automated match to d4igta_
   complexed with 4e5, act, edo, gol, so4

Details for d4ymab_

PDB Entry: 4yma, 1.9 Å

PDB Description: structure of the ligand-binding domain of glua2 in complex with the antagonist cng10109

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d4ymab_:

Sequence; same for both SEQRES and ATOM records:

>d4ymab_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecgs

Timeline for d4ymab_:

• d4ymab_ first appeared in SCOPe 2.05
  
• d4ymab_ appears in SCOPe 2.06
  
• d4ymab_ appears in the current release, SCOPe 2.08