Lineage for d4y14b_ (4y14 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116409Protein Tyrosine phosphatase [52806] (7 species)
  7. 2116410Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (128 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 2116506Domain d4y14b_: 4y14 B: [275721]
    automated match to d2cnia_
    complexed with c0a, cl, gol, trs

Details for d4y14b_

PDB Entry: 4y14 (more details), 1.9 Å

PDB Description: structure of protein tyrosine phosphatase 1b complexed with inhibitor (ptp1b:cpt157633)
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d4y14b_:

Sequence, based on SEQRES records: (download)

>d4y14b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedlep

Sequence, based on observed residues (ATOM records): (download)

>d4y14b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrsvd
ikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedlep

SCOPe Domain Coordinates for d4y14b_:

Click to download the PDB-style file with coordinates for d4y14b_.
(The format of our PDB-style files is described here.)

Timeline for d4y14b_: