Lineage for d1ingb_ (1ing B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62718Protein Influenza neuraminidase [50943] (2 species)
  7. 62719Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries)
  8. 62748Domain d1ingb_: 1ing B: [27572]

Details for d1ingb_

PDB Entry: 1ing (more details), 2.4 Å

PDB Description: influenza a subtype n2 neuraminidase complexed with aromatic bana109 inhibitor

SCOP Domain Sequences for d1ingb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ingb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza A virus, different strains}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOP Domain Coordinates for d1ingb_:

Click to download the PDB-style file with coordinates for d1ingb_.
(The format of our PDB-style files is described here.)

Timeline for d1ingb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1inga_