![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
![]() | Protein automated matches [191011] (13 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:563041] [275714] (1 PDB entry) |
![]() | Domain d4xfwa_: 4xfw A: [275715] automated match to d1koqb_ complexed with acy, cl, so4, zn |
PDB Entry: 4xfw (more details), 1.52 Å
SCOPe Domain Sequences for d4xfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xfwa_ b.74.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]} kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw fvveeplevsakqlaeikkrmknspnqrpvqpdyntviikrsaetr
Timeline for d4xfwa_: