SCOPe 2.06: Domain d4xfwa_: 4xfw A:

Lineage for d4xfwa_ (4xfw A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (13 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:563041] [275714] (1 PDB entry)

8. Domain d4xfwa_: 4xfw A: [275715]
   automated match to d1koqb_
   complexed with acy, cl, so4, zn

Details for d4xfwa_

PDB Entry: 4xfw, 1.52 Å

PDB Description: crystal structure of the monoclinic form of alpha-carbonic anhydrase from the human pathogen helicobacter pylori

PDB Compounds: (A:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d4xfwa_:

Sequence; same for both SEQRES and ATOM records:

>d4xfwa_ b.74.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]}
kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
fvveeplevsakqlaeikkrmknspnqrpvqpdyntviikrsaetr

Timeline for d4xfwa_:

• d4xfwa_ first appeared in SCOPe 2.05
  
• d4xfwa_ appears in the current release, SCOPe 2.07