Lineage for d4wz4a_ (4wz4 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014929Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries)
  8. 3014934Domain d4wz4a_: 4wz4 A: [275705]
    automated match to d3s1ya_
    complexed with 3vu, gol

Details for d4wz4a_

PDB Entry: 4wz4 (more details), 1.05 Å

PDB Description: crystal structure of p. aeruginosa ampc
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4wz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wz4a_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
apadrlkalvdaavqpvmkandipglavaislkgephyfsyglaskedgrrvtpetlfei
gsvsktftatlagyaltqdkmrlddrasqhwpalqgsrfdgislldlatytagglplqfp
dsvqkdqaqirdyyrqwqptyapgsqrlysnpsiglfgylaarslgqpferlmeqqvfpa
lgleqthldvpeaalaqyaqgygkddrplrvgpgpldaegygvktsaadllrfvdanlhp
erldrpwaqaldathrgyykvgdmtqglgweaydwpislkrlqagnstpmalqphriarl
papqalegqrllnktgstngfgayvafvpgrdlglvilanrnypnaervkiayailsgle

SCOPe Domain Coordinates for d4wz4a_:

Click to download the PDB-style file with coordinates for d4wz4a_.
(The format of our PDB-style files is described here.)

Timeline for d4wz4a_: