Lineage for d4wn5a1 (4wn5 A:237-343)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2535027Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2535028Protein automated matches [190492] (22 species)
    not a true protein
  7. 2535063Species Human (Homo sapiens) [TaxId:9606] [187434] (25 PDB entries)
  8. 2535064Domain d4wn5a1: 4wn5 A:237-343 [275696]
    Other proteins in same PDB: d4wn5a2
    automated match to d1p97a_
    complexed with mvc, p6g, so4

Details for d4wn5a1

PDB Entry: 4wn5 (more details), 1.15 Å

PDB Description: crystal structure of the c-terminal per-arnt-sim (pasb) of human hif- 3alpha9 bound to 18:1-1-monoacylglycerol
PDB Compounds: (A:) Hypoxia-inducible factor 3-alpha

SCOPe Domain Sequences for d4wn5a1:

Sequence, based on SEQRES records: (download)

>d4wn5a1 d.110.3.0 (A:237-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgaflsrhsldmkftycddriaevagyspddligcsayeyihaldsdavsksihtllsk
gqavtgqyrflarsggylwtqtqatvvsggrgpqsesivcvhflisq

Sequence, based on observed residues (ATOM records): (download)

>d4wn5a1 d.110.3.0 (A:237-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgaflsrhsldmkftycddriaevagyspddligcsayeyihaldsdavsksihtllsk
gqavtgqyrflarsggylwtqtqatvvsgrgpqsesivcvhflisq

SCOPe Domain Coordinates for d4wn5a1:

Click to download the PDB-style file with coordinates for d4wn5a1.
(The format of our PDB-style files is described here.)

Timeline for d4wn5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wn5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4wn5b_