SCOPe 2.07: Domain d4wh4a1: 4wh4 A:3-56

Lineage for d4wh4a1 (4wh4 A:3-56)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp. [TaxId:1320] [193546] (12 PDB entries)

8. Domain d4wh4a1: 4wh4 A:3-56 [275694]
   Other proteins in same PDB: d4wh4a2, d4wh4b2
   automated match to d2qmta_
   complexed with gol, so4; mutant

Details for d4wh4a1

PDB Entry: 4wh4, 2.2 Å

PDB Description: protein gb1 quadruple mutant i6h/n8h/k28h/q32h

PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d4wh4a1:

Sequence; same for both SEQRES and ATOM records:

>d4wh4a1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
yklhlhgktlkgettteavdaataehvfkhyandngvdgewtyddatktftvte

Timeline for d4wh4a1:

• d4wh4a1 first appeared in SCOPe 2.05, called d4wh4a_
  
• d4wh4a1 appears in SCOPe 2.06
  
• d4wh4a1 appears in the current release, SCOPe 2.08