Lineage for d4uhph1 (4uhp H:1-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319355Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2319640Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2319696Family a.28.2.0: automated matches [273669] (1 protein)
    not a true family
  6. 2319697Protein automated matches [273670] (2 species)
    not a true protein
  7. 2319700Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273671] (2 PDB entries)
  8. 2319708Domain d4uhph1: 4uhp H:1-90 [275684]
    Other proteins in same PDB: d4uhpa_, d4uhpc_, d4uhpe_, d4uhpf2, d4uhpg_, d4uhph2
    automated match to d3u43a_
    protein/DNA complex

Details for d4uhph1

PDB Entry: 4uhp (more details), 2 Å

PDB Description: crystal structure of the pyocin ap41 dnase-immunity complex
PDB Compounds: (H:) bacteriocin immunity protein

SCOPe Domain Sequences for d4uhph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhph1 a.28.2.0 (H:1-90) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mdiknnlsdytesefleiieeffknksglkgselekrmdklvkhfeevtshprksgvifh
pkpgfetpegivkevkewraanglpgfkag

SCOPe Domain Coordinates for d4uhph1:

Click to download the PDB-style file with coordinates for d4uhph1.
(The format of our PDB-style files is described here.)

Timeline for d4uhph1: