SCOPe 2.06: Domain d4uhph1: 4uhp H:1-90

Lineage for d4uhph1 (4uhp H:1-90)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.0: automated matches [273669] (1 protein)
   not a true family

6. Protein automated matches [273670] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273671] (2 PDB entries)

8. Domain d4uhph1: 4uhp H:1-90 [275684]
   Other proteins in same PDB: d4uhpa_, d4uhpc_, d4uhpe_, d4uhpf2, d4uhpg_, d4uhph2
   automated match to d3u43a_
   protein/DNA complex

Details for d4uhph1

PDB Entry: 4uhp, 2 Å

PDB Description: crystal structure of the pyocin ap41 dnase-immunity complex

PDB Compounds: (H:) bacteriocin immunity protein

SCOPe Domain Sequences for d4uhph1:

Sequence; same for both SEQRES and ATOM records:

>d4uhph1 a.28.2.0 (H:1-90) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mdiknnlsdytesefleiieeffknksglkgselekrmdklvkhfeevtshprksgvifh
pkpgfetpegivkevkewraanglpgfkag

Timeline for d4uhph1:

• d4uhph1 first appeared in SCOPe 2.05, called d4uhph_
  
• d4uhph1 appears in SCOPe 2.07
  
• d4uhph1 appears in the current release, SCOPe 2.08