![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
![]() | Family a.28.2.0: automated matches [273669] (1 protein) not a true family |
![]() | Protein automated matches [273670] (2 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273671] (2 PDB entries) |
![]() | Domain d4uhph1: 4uhp H:1-90 [275684] Other proteins in same PDB: d4uhpa_, d4uhpc_, d4uhpe_, d4uhpf2, d4uhpg_, d4uhph2 automated match to d3u43a_ protein/DNA complex |
PDB Entry: 4uhp (more details), 2 Å
SCOPe Domain Sequences for d4uhph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhph1 a.28.2.0 (H:1-90) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mdiknnlsdytesefleiieeffknksglkgselekrmdklvkhfeevtshprksgvifh pkpgfetpegivkevkewraanglpgfkag
Timeline for d4uhph1: