| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
| Family a.28.2.0: automated matches [273669] (1 protein) not a true family |
| Protein automated matches [273670] (1 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273671] (2 PDB entries) |
| Domain d4uhpd_: 4uhp D: [275681] Other proteins in same PDB: d4uhpa_, d4uhpc_, d4uhpe_, d4uhpf2, d4uhpg_, d4uhph2 automated match to d3u43a_ protein/DNA complex |
PDB Entry: 4uhp (more details), 2 Å
SCOPe Domain Sequences for d4uhpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhpd_ a.28.2.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
knnlsdytesefleiieeffknksglkgselekrmdklvkhfeevtshprksgvifhpkp
gfetpegivkevkewraanglpgfkag
Timeline for d4uhpd_: