Lineage for d4uhpd_ (4uhp D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731236Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 1731292Family a.28.2.0: automated matches [273669] (1 protein)
    not a true family
  6. 1731293Protein automated matches [273670] (1 species)
    not a true protein
  7. 1731294Species Pseudomonas aeruginosa [TaxId:208964] [273671] (2 PDB entries)
  8. 1731300Domain d4uhpd_: 4uhp D: [275681]
    Other proteins in same PDB: d4uhpa_, d4uhpc_, d4uhpe_, d4uhpg_
    automated match to d3u43a_
    protein/DNA complex

Details for d4uhpd_

PDB Entry: 4uhp (more details), 2 Å

PDB Description: crystal structure of the pyocin ap41 dnase-immunity complex
PDB Compounds: (D:) bacteriocin immunity protein

SCOPe Domain Sequences for d4uhpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhpd_ a.28.2.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
knnlsdytesefleiieeffknksglkgselekrmdklvkhfeevtshprksgvifhpkp
gfetpegivkevkewraanglpgfkag

SCOPe Domain Coordinates for d4uhpd_:

Click to download the PDB-style file with coordinates for d4uhpd_.
(The format of our PDB-style files is described here.)

Timeline for d4uhpd_: